Placeholder image of a protein
Icon representing a puzzle

1826: Coronavirus Trimmed ORF8 Prediction

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 16, 2020
Expires
Max points
100
Description

This is a follow-up to Puzzle 1823, but players noticed that the first 15 amino acids are highly predicted to be a signal peptide, so we have trimmed those residues from this puzzle. This protein is encoded in the viral genome of SARS-CoV-2, but the protein's structure is still unknown. If we knew how this protein folds, we might be able to figure out its exact function. Refold this different starting model to find higher-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups



  1. Avatar for titinmarlon7 461. titinmarlon7 Lv 1 1 pt. 0
  2. Avatar for combatgom 462. combatgom Lv 1 1 pt. 0
  3. Avatar for Derli 464. Derli Lv 1 1 pt. 0
  4. Avatar for Onyx124 465. Onyx124 Lv 1 1 pt. 0
  5. Avatar for Sersud1971 466. Sersud1971 Lv 1 1 pt. 0
  6. Avatar for Nick222 467. Nick222 Lv 1 1 pt. 0
  7. Avatar for SaloFox_00 468. SaloFox_00 Lv 1 1 pt. 0
  8. Avatar for Arieldz 469. Arieldz Lv 1 1 pt. 0
  9. Avatar for alexjaks88 470. alexjaks88 Lv 1 1 pt. 0

Comments


Formula350 Lv 1

That was my exact thinking. I just had never personally encountered one where (seemingly) arbitrary spaces get replaced like that! lol
I've seen apostrophes, line-breaks, special characters (like accented or other language), but can't say I've seen spaces! :D

I'm admittedly curious what DID end up to be the cause, now that it's fixed! heh

LociOiling Lv 1

Client shows I've soared to #1 on 1826, but website shows Steven Pletsch is still in command.

Something is borken.

beta_helix Staff Lv 1

Unfortunately, we really don't have any additional information about this protein… so we can't be confident one way or another.

I would suggest trying different topologies with and without disulfide bonds.

agcohn821 Staff Lv 1

Hi there! If you're interested in learning more and getting higher scores, I would suggest joining our discord channel to chat with other players and maybe get some helpful pointers!