Placeholder image of a protein
Icon representing a puzzle

1826: Coronavirus Trimmed ORF8 Prediction

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 16, 2020
Expires
Max points
100
Description

This is a follow-up to Puzzle 1823, but players noticed that the first 15 amino acids are highly predicted to be a signal peptide, so we have trimmed those residues from this puzzle. This protein is encoded in the viral genome of SARS-CoV-2, but the protein's structure is still unknown. If we knew how this protein folds, we might be able to figure out its exact function. Refold this different starting model to find higher-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups



  1. Avatar for manu8170 61. manu8170 Lv 1 59 pts. 9,379
  2. Avatar for pvc78 62. pvc78 Lv 1 58 pts. 9,341
  3. Avatar for drumpeter18yrs9yrs 63. drumpeter18yrs9yrs Lv 1 58 pts. 9,330
  4. Avatar for John McLeod 64. John McLeod Lv 1 57 pts. 9,328
  5. Avatar for LastAndroid 65. LastAndroid Lv 1 57 pts. 9,328
  6. Avatar for aendgraend 66. aendgraend Lv 1 56 pts. 9,325
  7. Avatar for lraguette 67. lraguette Lv 1 55 pts. 9,313
  8. Avatar for Blipperman 68. Blipperman Lv 1 55 pts. 9,291
  9. Avatar for WBarme1234 69. WBarme1234 Lv 1 54 pts. 9,281
  10. Avatar for RW-QuantumSec 70. RW-QuantumSec Lv 1 54 pts. 9,276

Comments


Xartos Lv 1

I have some issue with the scoreboard. Cant see the scores from other players. Only getting a text saying 'Getting player list…'

Formula350 Lv 1

Was that it might have something to do with however the puzzle was made. My thinking is that whatever caused the puzzle's description to get goofed up with ?s being randomly swapped in for spaces, might also have caused a hidden issue in the puzzle's name, too.
If that's the case, perhaps the server isn't able to properly recognize the title and can't generate the scoreboard?

MaciekB Lv 1

It could be encoding error. Some encodings has different character codes for space or new line (it would explain those ?s) and different characters too.