Placeholder image of a protein
Icon representing a puzzle

1826: Coronavirus Trimmed ORF8 Prediction

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 16, 2020
Expires
Max points
100
Description

This is a follow-up to Puzzle 1823, but players noticed that the first 15 amino acids are highly predicted to be a signal peptide, so we have trimmed those residues from this puzzle. This protein is encoded in the viral genome of SARS-CoV-2, but the protein's structure is still unknown. If we knew how this protein folds, we might be able to figure out its exact function. Refold this different starting model to find higher-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups


  1. Avatar for incognito group 31. incognito group 1 pt. 0

  1. Avatar for ucad 111. ucad Lv 1 36 pts. 8,600
  2. Avatar for Dudit 112. Dudit Lv 1 35 pts. 8,575
  3. Avatar for sitlux 113. sitlux Lv 1 35 pts. 8,566
  4. Avatar for RiaSkies 114. RiaSkies Lv 1 35 pts. 8,541
  5. Avatar for evifnoskcaj 115. evifnoskcaj Lv 1 34 pts. 8,525
  6. Avatar for CHM2211CAPBsp2020 116. CHM2211CAPBsp2020 Lv 1 34 pts. 8,508
  7. Avatar for JasperD 117. JasperD Lv 1 34 pts. 8,491
  8. Avatar for Arne Heessels 118. Arne Heessels Lv 1 33 pts. 8,490
  9. Avatar for jamiexq 119. jamiexq Lv 1 33 pts. 8,470
  10. Avatar for Pazithi 120. Pazithi Lv 1 33 pts. 8,465

Comments


Xartos Lv 1

I have some issue with the scoreboard. Cant see the scores from other players. Only getting a text saying 'Getting player list…'

Formula350 Lv 1

Was that it might have something to do with however the puzzle was made. My thinking is that whatever caused the puzzle's description to get goofed up with ?s being randomly swapped in for spaces, might also have caused a hidden issue in the puzzle's name, too.
If that's the case, perhaps the server isn't able to properly recognize the title and can't generate the scoreboard?

MaciekB Lv 1

It could be encoding error. Some encodings has different character codes for space or new line (it would explain those ?s) and different characters too.