Placeholder image of a protein
Icon representing a puzzle

1826: Coronavirus Trimmed ORF8 Prediction

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 16, 2020
Expires
Max points
100
Description

This is a follow-up to Puzzle 1823, but players noticed that the first 15 amino acids are highly predicted to be a signal peptide, so we have trimmed those residues from this puzzle. This protein is encoded in the viral genome of SARS-CoV-2, but the protein's structure is still unknown. If we knew how this protein folds, we might be able to figure out its exact function. Refold this different starting model to find higher-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,292
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 85 pts. 10,228
  3. Avatar for Hold My Beer 3. Hold My Beer 71 pts. 10,225
  4. Avatar for Gargleblasters 4. Gargleblasters 60 pts. 10,211
  5. Avatar for Beta Folders 5. Beta Folders 49 pts. 10,177
  6. Avatar for Contenders 6. Contenders 41 pts. 10,102
  7. Avatar for Void Crushers 7. Void Crushers 33 pts. 10,024
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 27 pts. 9,649
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 22 pts. 9,473
  10. Avatar for Penny-Arcade 10. Penny-Arcade 17 pts. 9,328
  1. Avatar for Chrisn00 331. Chrisn00 Lv 1 2 pts. 5,219
  2. Avatar for RaquelF 332. RaquelF Lv 1 2 pts. 5,219
  3. Avatar for eliciatrujillo 333. eliciatrujillo Lv 1 2 pts. 5,211
  4. Avatar for CHM1045C943JSsp2020 334. CHM1045C943JSsp2020 Lv 1 2 pts. 5,203
  5. Avatar for Tangles 335. Tangles Lv 1 2 pts. 5,188
  6. Avatar for AlkiP0Ps 336. AlkiP0Ps Lv 1 2 pts. 5,179
  7. Avatar for Candellila 337. Candellila Lv 1 2 pts. 5,155
  8. Avatar for aed10 338. aed10 Lv 1 2 pts. 5,151
  9. Avatar for prodbykoch 339. prodbykoch Lv 1 2 pts. 5,150
  10. Avatar for raulbasket96 340. raulbasket96 Lv 1 2 pts. 5,142

Comments

Formula350 Lv 1

That was my exact thinking. I just had never personally encountered one where (seemingly) arbitrary spaces get replaced like that! lol
I've seen apostrophes, line-breaks, special characters (like accented or other language), but can't say I've seen spaces! :D

I'm admittedly curious what DID end up to be the cause, now that it's fixed! heh

LociOiling Lv 1

Client shows I've soared to #1 on 1826, but website shows Steven Pletsch is still in command.

Something is borken.

beta_helix Staff Lv 1

Unfortunately, we really don't have any additional information about this protein… so we can't be confident one way or another.

I would suggest trying different topologies with and without disulfide bonds.

agcohn821 Staff Lv 1

Hi there! If you're interested in learning more and getting higher scores, I would suggest joining our discord channel to chat with other players and maybe get some helpful pointers!