Placeholder image of a protein
Icon representing a puzzle

1826: Coronavirus Trimmed ORF8 Prediction

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 16, 2020
Expires
Max points
100
Description

This is a follow-up to Puzzle 1823, but players noticed that the first 15 amino acids are highly predicted to be a signal peptide, so we have trimmed those residues from this puzzle. This protein is encoded in the viral genome of SARS-CoV-2, but the protein's structure is still unknown. If we knew how this protein folds, we might be able to figure out its exact function. Refold this different starting model to find higher-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,292
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 85 pts. 10,228
  3. Avatar for Hold My Beer 3. Hold My Beer 71 pts. 10,225
  4. Avatar for Gargleblasters 4. Gargleblasters 60 pts. 10,211
  5. Avatar for Beta Folders 5. Beta Folders 49 pts. 10,177
  6. Avatar for Contenders 6. Contenders 41 pts. 10,102
  7. Avatar for Void Crushers 7. Void Crushers 33 pts. 10,024
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 27 pts. 9,649
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 22 pts. 9,473
  10. Avatar for Penny-Arcade 10. Penny-Arcade 17 pts. 9,328
  1. Avatar for MaciekB 91. MaciekB Lv 1 44 pts. 8,948
  2. Avatar for Blue102 92. Blue102 Lv 1 43 pts. 8,922
  3. Avatar for stomjoh 93. stomjoh Lv 1 43 pts. 8,922
  4. Avatar for Merf 94. Merf Lv 1 43 pts. 8,914
  5. Avatar for Dhalion 95. Dhalion Lv 1 42 pts. 8,881
  6. Avatar for PeterDav 96. PeterDav Lv 1 42 pts. 8,854
  7. Avatar for GenGF 97. GenGF Lv 1 41 pts. 8,852
  8. Avatar for bcre8tvv 98. bcre8tvv Lv 1 41 pts. 8,780
  9. Avatar for Crossed Sticks 99. Crossed Sticks Lv 1 40 pts. 8,778
  10. Avatar for jausmh 100. jausmh Lv 1 40 pts. 8,774

Comments

Xartos Lv 1

I have some issue with the scoreboard. Cant see the scores from other players. Only getting a text saying 'Getting player list…'

Formula350 Lv 1

Was that it might have something to do with however the puzzle was made. My thinking is that whatever caused the puzzle's description to get goofed up with ?s being randomly swapped in for spaces, might also have caused a hidden issue in the puzzle's name, too.
If that's the case, perhaps the server isn't able to properly recognize the title and can't generate the scoreboard?

MaciekB Lv 1

It could be encoding error. Some encodings has different character codes for space or new line (it would explain those ?s) and different characters too.