Placeholder image of a protein
Icon representing a puzzle

1826: Coronavirus Trimmed ORF8 Prediction

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 16, 2020
Expires
Max points
100
Description

This is a follow-up to Puzzle 1823, but players noticed that the first 15 amino acids are highly predicted to be a signal peptide, so we have trimmed those residues from this puzzle. This protein is encoded in the viral genome of SARS-CoV-2, but the protein's structure is still unknown. If we knew how this protein folds, we might be able to figure out its exact function. Refold this different starting model to find higher-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,292
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 85 pts. 10,228
  3. Avatar for Hold My Beer 3. Hold My Beer 71 pts. 10,225
  4. Avatar for Gargleblasters 4. Gargleblasters 60 pts. 10,211
  5. Avatar for Beta Folders 5. Beta Folders 49 pts. 10,177
  6. Avatar for Contenders 6. Contenders 41 pts. 10,102
  7. Avatar for Void Crushers 7. Void Crushers 33 pts. 10,024
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 27 pts. 9,649
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 22 pts. 9,473
  10. Avatar for Penny-Arcade 10. Penny-Arcade 17 pts. 9,328
  1. Avatar for wudoo 201. wudoo Lv 1 13 pts. 7,062
  2. Avatar for Ertonier 202. Ertonier Lv 1 13 pts. 7,040
  3. Avatar for foldit20test 203. foldit20test Lv 1 13 pts. 7,019
  4. Avatar for DScott 204. DScott Lv 1 12 pts. 6,996
  5. Avatar for Killer_Kitten 205. Killer_Kitten Lv 1 12 pts. 6,922
  6. Avatar for deathstar 206. deathstar Lv 1 12 pts. 6,885
  7. Avatar for dahast.de 207. dahast.de Lv 1 12 pts. 6,875
  8. Avatar for badgoes 208. badgoes Lv 1 12 pts. 6,837
  9. Avatar for felixxy 209. felixxy Lv 1 12 pts. 6,818
  10. Avatar for aspadistra 210. aspadistra Lv 1 11 pts. 6,754

Comments

Xartos Lv 1

I have some issue with the scoreboard. Cant see the scores from other players. Only getting a text saying 'Getting player list…'

Formula350 Lv 1

Was that it might have something to do with however the puzzle was made. My thinking is that whatever caused the puzzle's description to get goofed up with ?s being randomly swapped in for spaces, might also have caused a hidden issue in the puzzle's name, too.
If that's the case, perhaps the server isn't able to properly recognize the title and can't generate the scoreboard?

MaciekB Lv 1

It could be encoding error. Some encodings has different character codes for space or new line (it would explain those ?s) and different characters too.