Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Herobrine's Army 11. Herobrine's Army 5 pts. 10,571
  2. Avatar for CHNO Junkies 12. CHNO Junkies 4 pts. 10,543
  3. Avatar for Penny-Arcade 13. Penny-Arcade 2 pts. 10,528
  4. Avatar for Russian team 14. Russian team 2 pts. 10,363
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,296
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 10,206
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 10,183
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 9,771
  9. Avatar for Coastal Biochemistry 19. Coastal Biochemistry 1 pt. 9,764
  10. Avatar for Team China 20. Team China 1 pt. 9,646
  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 10,885
  2. Avatar for pauldunn 2. pauldunn Lv 1 99 pts. 10,850
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 97 pts. 10,818
  4. Avatar for Galaxie 4. Galaxie Lv 1 95 pts. 10,799
  5. Avatar for LociOiling 5. LociOiling Lv 1 93 pts. 10,792
  6. Avatar for spmm 6. spmm Lv 1 91 pts. 10,789
  7. Avatar for mirp 7. mirp Lv 1 90 pts. 10,784
  8. Avatar for jobo0502 8. jobo0502 Lv 1 88 pts. 10,783
  9. Avatar for KarenCH 9. KarenCH Lv 1 86 pts. 10,768
  10. Avatar for aznarog 10. aznarog Lv 1 85 pts. 10,751

Comments