Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for https://fold.it/portal/Chem445_2021 22. https://fold.it/portal/Chem445_2021 1 pt. 9,039
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829
  1. Avatar for tamanrasset 91. tamanrasset Lv 1 13 pts. 10,243
  2. Avatar for argyrw 92. argyrw Lv 1 13 pts. 10,239
  3. Avatar for badgoes 93. badgoes Lv 1 13 pts. 10,233
  4. Avatar for backterria 94. backterria Lv 1 12 pts. 10,227
  5. Avatar for sflowers 95. sflowers Lv 1 12 pts. 10,223
  6. Avatar for pfirth 96. pfirth Lv 1 12 pts. 10,223
  7. Avatar for RW-QuantumSec 97. RW-QuantumSec Lv 1 11 pts. 10,220
  8. Avatar for SKSbell 98. SKSbell Lv 1 11 pts. 10,217
  9. Avatar for heather-1 99. heather-1 Lv 1 11 pts. 10,215
  10. Avatar for kitek314_pl 100. kitek314_pl Lv 1 10 pts. 10,206

Comments