Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829

  1. Avatar for wudoo 111. wudoo Lv 1 8 pts. 10,150
  2. Avatar for abiogenesis 112. abiogenesis Lv 1 7 pts. 10,149
  3. Avatar for Evica 113. Evica Lv 1 7 pts. 10,146
  4. Avatar for obbo 114. obbo Lv 1 7 pts. 10,145
  5. Avatar for haggisfam 115. haggisfam Lv 1 7 pts. 10,145
  6. Avatar for sgeldhof 116. sgeldhof Lv 1 6 pts. 10,140
  7. Avatar for manu8170 117. manu8170 Lv 1 6 pts. 10,139
  8. Avatar for Trajan464 118. Trajan464 Lv 1 6 pts. 10,134
  9. Avatar for Pikkachurin 119. Pikkachurin Lv 1 6 pts. 10,127
  10. Avatar for MnSk 120. MnSk Lv 1 6 pts. 10,127

Comments