Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for https://fold.it/portal/Chem445_2021 22. https://fold.it/portal/Chem445_2021 1 pt. 9,039
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829
  1. Avatar for John McLeod 121. John McLeod Lv 1 6 pts. 10,115
  2. Avatar for tangofox10 122. tangofox10 Lv 1 5 pts. 10,105
  3. Avatar for Blipperman 123. Blipperman Lv 1 5 pts. 10,102
  4. Avatar for motu 124. motu Lv 1 5 pts. 10,092
  5. Avatar for alcor29 125. alcor29 Lv 1 5 pts. 10,084
  6. Avatar for Feet1stEvolves 126. Feet1stEvolves Lv 1 5 pts. 10,078
  7. Avatar for fanchunhui 127. fanchunhui Lv 1 5 pts. 10,076
  8. Avatar for pangaena 128. pangaena Lv 1 4 pts. 10,074
  9. Avatar for bacteria-casX-covid 129. bacteria-casX-covid Lv 1 4 pts. 10,066
  10. Avatar for Mohoernchen 130. Mohoernchen Lv 1 4 pts. 10,066

Comments