Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for https://fold.it/portal/Chem445_2021 22. https://fold.it/portal/Chem445_2021 1 pt. 9,039
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829
  1. Avatar for sciencewalker 131. sciencewalker Lv 1 4 pts. 10,066
  2. Avatar for lraguette 132. lraguette Lv 1 4 pts. 10,062
  3. Avatar for deconstruct 133. deconstruct Lv 1 4 pts. 10,061
  4. Avatar for jlucky711 134. jlucky711 Lv 1 4 pts. 10,059
  5. Avatar for rinze 135. rinze Lv 1 4 pts. 10,056
  6. Avatar for emreozkul 136. emreozkul Lv 1 3 pts. 10,042
  7. Avatar for meatexplosion 137. meatexplosion Lv 1 3 pts. 10,034
  8. Avatar for Pikamander2 138. Pikamander2 Lv 1 3 pts. 10,025
  9. Avatar for ShadowTactics 139. ShadowTactics Lv 1 3 pts. 9,998
  10. Avatar for edpalas 140. edpalas Lv 1 3 pts. 9,985

Comments