Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829

  1. Avatar for firejuggler 141. firejuggler Lv 1 3 pts. 9,984
  2. Avatar for reich64 142. reich64 Lv 1 3 pts. 9,971
  3. Avatar for xbp 143. xbp Lv 1 3 pts. 9,961
  4. Avatar for Trematode1980 144. Trematode1980 Lv 1 3 pts. 9,958
  5. Avatar for rabamino12358 145. rabamino12358 Lv 1 3 pts. 9,952
  6. Avatar for MrZanav 146. MrZanav Lv 1 2 pts. 9,946
  7. Avatar for G d S 147. G d S Lv 1 2 pts. 9,943
  8. Avatar for Ertonier 148. Ertonier Lv 1 2 pts. 9,940
  9. Avatar for Gerom 149. Gerom Lv 1 2 pts. 9,930
  10. Avatar for ProfVince 150. ProfVince Lv 1 2 pts. 9,926

Comments