Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for https://fold.it/portal/Chem445_2021 22. https://fold.it/portal/Chem445_2021 1 pt. 9,039
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829
  1. Avatar for sitlux 171. sitlux Lv 1 1 pt. 9,783
  2. Avatar for bolloforbio 172. bolloforbio Lv 1 1 pt. 9,778
  3. Avatar for Hum 173. Hum Lv 1 1 pt. 9,774
  4. Avatar for dange43 174. dange43 Lv 1 1 pt. 9,772
  5. Avatar for Savas 175. Savas Lv 1 1 pt. 9,771
  6. Avatar for anthion 176. anthion Lv 1 1 pt. 9,768
  7. Avatar for jrabrams 177. jrabrams Lv 1 1 pt. 9,764
  8. Avatar for aniri 178. aniri Lv 1 1 pt. 9,761
  9. Avatar for mimovilla 179. mimovilla Lv 1 1 pt. 9,751
  10. Avatar for kastberg 180. kastberg Lv 1 1 pt. 9,748

Comments