Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for https://fold.it/portal/Chem445_2021 22. https://fold.it/portal/Chem445_2021 1 pt. 9,039
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829
  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 83 pts. 10,735
  2. Avatar for Phyx 12. Phyx Lv 1 82 pts. 10,718
  3. Avatar for TECHFREAK 13. TECHFREAK Lv 1 80 pts. 10,718
  4. Avatar for g_b 14. g_b Lv 1 78 pts. 10,710
  5. Avatar for drjr 15. drjr Lv 1 77 pts. 10,690
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 75 pts. 10,688
  7. Avatar for robgee 17. robgee Lv 1 74 pts. 10,675
  8. Avatar for Steven Pletsch 18. Steven Pletsch Lv 1 72 pts. 10,670
  9. Avatar for johnmitch 19. johnmitch Lv 1 71 pts. 10,669
  10. Avatar for georg137 20. georg137 Lv 1 70 pts. 10,661

Comments