Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for https://fold.it/portal/Chem445_2021 22. https://fold.it/portal/Chem445_2021 1 pt. 9,039
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829
  1. Avatar for Ashinto 201. Ashinto Lv 1 1 pt. 9,533
  2. Avatar for mikemarkelov 202. mikemarkelov Lv 1 1 pt. 9,533
  3. Avatar for DScott 203. DScott Lv 1 1 pt. 9,528
  4. Avatar for micon 204. micon Lv 1 1 pt. 9,525
  5. Avatar for Spentfire 205. Spentfire Lv 1 1 pt. 9,522
  6. Avatar for RetromanV3377 206. RetromanV3377 Lv 1 1 pt. 9,517
  7. Avatar for tlai 207. tlai Lv 1 1 pt. 9,516
  8. Avatar for Hiko N. 208. Hiko N. Lv 1 1 pt. 9,489
  9. Avatar for evifnoskcaj 209. evifnoskcaj Lv 1 1 pt. 9,488
  10. Avatar for Deleted player 210. Deleted player pts. 9,479

Comments