Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for https://fold.it/portal/Chem445_2021 22. https://fold.it/portal/Chem445_2021 1 pt. 9,039
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829
  1. Avatar for glockbaum 221. glockbaum Lv 1 1 pt. 9,347
  2. Avatar for Tlaloc 222. Tlaloc Lv 1 1 pt. 9,339
  3. Avatar for eazyC1212 223. eazyC1212 Lv 1 1 pt. 9,299
  4. Avatar for harvardman 224. harvardman Lv 1 1 pt. 9,299
  5. Avatar for YellowBearPL 225. YellowBearPL Lv 1 1 pt. 9,295
  6. Avatar for Nico-Rona 226. Nico-Rona Lv 1 1 pt. 9,292
  7. Avatar for Sendky1 227. Sendky1 Lv 1 1 pt. 9,291
  8. Avatar for RabbitXVI 228. RabbitXVI Lv 1 1 pt. 9,284
  9. Avatar for LocalHero 229. LocalHero Lv 1 1 pt. 9,277
  10. Avatar for M Siegrist 230. M Siegrist Lv 1 1 pt. 9,276

Comments