Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for https://fold.it/portal/Chem445_2021 22. https://fold.it/portal/Chem445_2021 1 pt. 9,039
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829
  1. Avatar for pattyloof 231. pattyloof Lv 1 1 pt. 9,266
  2. Avatar for Goodfellow 232. Goodfellow Lv 1 1 pt. 9,264
  3. Avatar for juliajcameron 233. juliajcameron Lv 1 1 pt. 9,255
  4. Avatar for claude45 234. claude45 Lv 1 1 pt. 9,251
  5. Avatar for mushrom81 235. mushrom81 Lv 1 1 pt. 9,231
  6. Avatar for Pyrodinium123 236. Pyrodinium123 Lv 1 1 pt. 9,211
  7. Avatar for teunlammetje 237. teunlammetje Lv 1 1 pt. 9,205
  8. Avatar for Datstandin 238. Datstandin Lv 1 1 pt. 9,107
  9. Avatar for BS99 239. BS99 Lv 1 1 pt. 9,106
  10. Avatar for Yamatada 240. Yamatada Lv 1 1 pt. 9,096

Comments