Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829

  1. Avatar for chafairi 251. chafairi Lv 1 1 pt. 8,715
  2. Avatar for GatoPandoric33 252. GatoPandoric33 Lv 1 1 pt. 8,711
  3. Avatar for JustinRothganger 253. JustinRothganger Lv 1 1 pt. 8,696
  4. Avatar for heinzmann41 254. heinzmann41 Lv 1 1 pt. 8,416
  5. Avatar for w500 255. w500 Lv 1 1 pt. 8,375
  6. Avatar for Gina1109 256. Gina1109 Lv 1 1 pt. 8,331
  7. Avatar for Puttering 257. Puttering Lv 1 1 pt. 8,070
  8. Avatar for momadoc 258. momadoc Lv 1 1 pt. 6,907
  9. Avatar for Lotus23 259. Lotus23 Lv 1 1 pt. 6,907
  10. Avatar for MrDuck09 260. MrDuck09 Lv 1 1 pt. 6,560

Comments