Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for https://fold.it/portal/Chem445_2021 22. https://fold.it/portal/Chem445_2021 1 pt. 9,039
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829
  1. Avatar for Jpilkington 21. Jpilkington Lv 1 68 pts. 10,659
  2. Avatar for pvc78 22. pvc78 Lv 1 67 pts. 10,648
  3. Avatar for cbwest 23. cbwest Lv 1 66 pts. 10,628
  4. Avatar for Deleted player 24. Deleted player pts. 10,627
  5. Avatar for silent gene 25. silent gene Lv 1 63 pts. 10,608
  6. Avatar for Timo van der Laan 26. Timo van der Laan Lv 1 62 pts. 10,607
  7. Avatar for TurtleByte 27. TurtleByte Lv 1 60 pts. 10,603
  8. Avatar for j.wohlmann 28. j.wohlmann Lv 1 59 pts. 10,590
  9. Avatar for inhtih 29. inhtih Lv 1 58 pts. 10,587
  10. Avatar for guineapig 30. guineapig Lv 1 57 pts. 10,580

Comments