Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for https://fold.it/portal/Chem445_2021 22. https://fold.it/portal/Chem445_2021 1 pt. 9,039
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829
  1. Avatar for dcrwheeler 31. dcrwheeler Lv 1 56 pts. 10,579
  2. Avatar for HerobrinesArmy 32. HerobrinesArmy Lv 1 54 pts. 10,571
  3. Avatar for nicobul 33. nicobul Lv 1 53 pts. 10,570
  4. Avatar for fiendish_ghoul 34. fiendish_ghoul Lv 1 52 pts. 10,564
  5. Avatar for BootsMcGraw 35. BootsMcGraw Lv 1 51 pts. 10,561
  6. Avatar for stomjoh 36. stomjoh Lv 1 50 pts. 10,561
  7. Avatar for OWM3 37. OWM3 Lv 1 49 pts. 10,556
  8. Avatar for Philzord 38. Philzord Lv 1 48 pts. 10,544
  9. Avatar for pmlkjn 39. pmlkjn Lv 1 47 pts. 10,543
  10. Avatar for jausmh 40. jausmh Lv 1 46 pts. 10,536

Comments