Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for https://fold.it/portal/Chem445_2021 22. https://fold.it/portal/Chem445_2021 1 pt. 9,039
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829
  1. Avatar for katling 41. katling Lv 1 45 pts. 10,531
  2. Avatar for LastAndroid 42. LastAndroid Lv 1 44 pts. 10,528
  3. Avatar for GuR0 43. GuR0 Lv 1 43 pts. 10,528
  4. Avatar for christioanchauvin 44. christioanchauvin Lv 1 42 pts. 10,527
  5. Avatar for Anfinsen_slept_here 45. Anfinsen_slept_here Lv 1 41 pts. 10,526
  6. Avatar for TheGUmmer 46. TheGUmmer Lv 1 40 pts. 10,516
  7. Avatar for phi16 47. phi16 Lv 1 39 pts. 10,516
  8. Avatar for Crossed Sticks 48. Crossed Sticks Lv 1 38 pts. 10,505
  9. Avatar for marsfan 49. marsfan Lv 1 38 pts. 10,498
  10. Avatar for CharlieFortsConscience 50. CharlieFortsConscience Lv 1 37 pts. 10,493

Comments