Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for https://fold.it/portal/Chem445_2021 22. https://fold.it/portal/Chem445_2021 1 pt. 9,039
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829
  1. Avatar for Vinara 51. Vinara Lv 1 36 pts. 10,488
  2. Avatar for Vman 52. Vman Lv 1 35 pts. 10,483
  3. Avatar for WBarme1234 53. WBarme1234 Lv 1 34 pts. 10,471
  4. Avatar for allie_heather47 54. allie_heather47 Lv 1 34 pts. 10,469
  5. Avatar for neon_fuzz 55. neon_fuzz Lv 1 33 pts. 10,458
  6. Avatar for Deleted player 56. Deleted player pts. 10,451
  7. Avatar for diamonddays 57. diamonddays Lv 1 31 pts. 10,450
  8. Avatar for Ignacio 58. Ignacio Lv 1 31 pts. 10,437
  9. Avatar for alwen 59. alwen Lv 1 30 pts. 10,432
  10. Avatar for wboler 60. wboler Lv 1 29 pts. 10,423

Comments