Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 9,339
  2. Avatar for https://fold.it/portal/Chem445_2021 22. https://fold.it/portal/Chem445_2021 1 pt. 9,039
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,829
  1. Avatar for spdenne 81. spdenne Lv 1 17 pts. 10,318
  2. Avatar for Idiotboy 82. Idiotboy Lv 1 17 pts. 10,299
  3. Avatar for Hellcat6 83. Hellcat6 Lv 1 16 pts. 10,297
  4. Avatar for JasperD 84. JasperD Lv 1 16 pts. 10,296
  5. Avatar for darixchel 85. darixchel Lv 1 16 pts. 10,284
  6. Avatar for Simek 86. Simek Lv 1 15 pts. 10,280
  7. Avatar for Superphosphate 87. Superphosphate Lv 1 15 pts. 10,268
  8. Avatar for Amphimixus 88. Amphimixus Lv 1 14 pts. 10,252
  9. Avatar for anton_rsol96 89. anton_rsol96 Lv 1 14 pts. 10,250
  10. Avatar for rezaefar 90. rezaefar Lv 1 14 pts. 10,246

Comments