Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,886
  2. Avatar for Go Science 2. Go Science 80 pts. 10,884
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 10,794
  4. Avatar for Void Crushers 4. Void Crushers 49 pts. 10,789
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 10,783
  6. Avatar for Marvin's bunch 6. Marvin's bunch 28 pts. 10,723
  7. Avatar for Team India 7. Team India 21 pts. 10,718
  8. Avatar for Hold My Beer 8. Hold My Beer 15 pts. 10,670
  9. Avatar for Contenders 9. Contenders 11 pts. 10,661
  10. Avatar for Gargleblasters 10. Gargleblasters 8 pts. 10,659
  1. Avatar for robgee 11. robgee Lv 1 19 pts. 10,860
  2. Avatar for RockOn 12. RockOn Lv 1 16 pts. 10,856
  3. Avatar for alcor29 13. alcor29 Lv 1 13 pts. 10,854
  4. Avatar for Pikamander2 14. Pikamander2 Lv 1 10 pts. 10,851
  5. Avatar for pauldunn 15. pauldunn Lv 1 8 pts. 10,850
  6. Avatar for LociOiling 16. LociOiling Lv 1 7 pts. 10,794
  7. Avatar for drjr 17. drjr Lv 1 5 pts. 10,791
  8. Avatar for alwen 18. alwen Lv 1 4 pts. 10,783
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 3 pts. 10,762
  10. Avatar for spdenne 20. spdenne Lv 1 2 pts. 10,758

Comments