Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,886
  2. Avatar for Go Science 2. Go Science 80 pts. 10,884
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 10,794
  4. Avatar for Void Crushers 4. Void Crushers 49 pts. 10,789
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 10,783
  6. Avatar for Marvin's bunch 6. Marvin's bunch 28 pts. 10,723
  7. Avatar for Team India 7. Team India 21 pts. 10,718
  8. Avatar for Hold My Beer 8. Hold My Beer 15 pts. 10,670
  9. Avatar for Contenders 9. Contenders 11 pts. 10,661
  10. Avatar for Gargleblasters 10. Gargleblasters 8 pts. 10,659

  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 83 pts. 10,735
  2. Avatar for Phyx 12. Phyx Lv 1 82 pts. 10,718
  3. Avatar for TECHFREAK 13. TECHFREAK Lv 1 80 pts. 10,718
  4. Avatar for g_b 14. g_b Lv 1 78 pts. 10,710
  5. Avatar for drjr 15. drjr Lv 1 77 pts. 10,690
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 75 pts. 10,688
  7. Avatar for robgee 17. robgee Lv 1 74 pts. 10,675
  8. Avatar for Steven Pletsch 18. Steven Pletsch Lv 1 72 pts. 10,670
  9. Avatar for johnmitch 19. johnmitch Lv 1 71 pts. 10,669
  10. Avatar for georg137 20. georg137 Lv 1 70 pts. 10,661

Comments