Placeholder image of a protein
Icon representing a puzzle

1830: Revisiting Puzzle 113: White Birch

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,886
  2. Avatar for Go Science 2. Go Science 80 pts. 10,884
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 10,794
  4. Avatar for Void Crushers 4. Void Crushers 49 pts. 10,789
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 10,783
  6. Avatar for Marvin's bunch 6. Marvin's bunch 28 pts. 10,723
  7. Avatar for Team India 7. Team India 21 pts. 10,718
  8. Avatar for Hold My Beer 8. Hold My Beer 15 pts. 10,670
  9. Avatar for Contenders 9. Contenders 11 pts. 10,661
  10. Avatar for Gargleblasters 10. Gargleblasters 8 pts. 10,659

  1. Avatar for fearr 261. fearr Lv 1 1 pt. 6,347
  2. Avatar for Deleted player 262. Deleted player 1 pt. 5,520
  3. Avatar for DodoBird 263. DodoBird Lv 1 1 pt. 5,520
  4. Avatar for RockOn 264. RockOn Lv 1 1 pt. 5,520
  5. Avatar for Mike Cassidy 265. Mike Cassidy Lv 1 1 pt. 5,520
  6. Avatar for ZJUrjz 266. ZJUrjz Lv 1 1 pt. 5,520
  7. Avatar for KB80 267. KB80 Lv 1 1 pt. 5,520
  8. Avatar for puxatudo 268. puxatudo Lv 1 1 pt. 5,520

Comments