Placeholder image of a protein
Icon representing a puzzle

1835: Coronavirus NSP2 Prediction

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
May 07, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This is one portion of a larger protein encoded in the viral genome of SARS-CoV-2. It is encoded in a region of the genome called NSP2, but the protein's structure and function are still unknown. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


AARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFF

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 7 pts. 11,037
  2. Avatar for Chem Eng Thermo 12. Chem Eng Thermo 5 pts. 10,766
  3. Avatar for Penny-Arcade 13. Penny-Arcade 4 pts. 10,644
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 3 pts. 10,113
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 2 pts. 9,988
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 9,455
  7. Avatar for Russian team 17. Russian team 1 pt. 8,941
  8. Avatar for Team China 18. Team China 1 pt. 8,113
  9. Avatar for CHNO Junkies 19. CHNO Junkies 1 pt. 7,310
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,625

  1. Avatar for Gerom 181. Gerom Lv 1 5 pts. 8,941
  2. Avatar for sitlux 182. sitlux Lv 1 5 pts. 8,940
  3. Avatar for Feet1stEvolves 183. Feet1stEvolves Lv 1 5 pts. 8,913
  4. Avatar for rabamino12358 184. rabamino12358 Lv 1 5 pts. 8,879
  5. Avatar for Pibeagles1 185. Pibeagles1 Lv 1 5 pts. 8,874
  6. Avatar for Vincera 186. Vincera Lv 1 4 pts. 8,850
  7. Avatar for Evica 187. Evica Lv 1 4 pts. 8,840
  8. Avatar for tom2705 188. tom2705 Lv 1 4 pts. 8,836
  9. Avatar for rinze 189. rinze Lv 1 4 pts. 8,832
  10. Avatar for pruneau_44 190. pruneau_44 Lv 1 4 pts. 8,799

Comments


Steven Pletsch Lv 1

I ran my own psipred prediction on this. Only place it varies significantly is that it predicted the small helix to just as likely be a sheet, so I stripped color from any segments that had a low confidence and converted the small helix to a sheet, making a small sheet pair with cysteine at the end of each. Though I haven't been able to get a disulfide bond that keeps the score up, it puts all 3 cysteine together in the same small pocket.