Placeholder image of a protein
Icon representing a puzzle

1835: Coronavirus NSP2 Prediction

Closed since almost 6 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
May 07, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This is one portion of a larger protein encoded in the viral genome of SARS-CoV-2. It is encoded in a region of the genome called NSP2, but the protein's structure and function are still unknown. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


AARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFF

Top groups

  1. Avatar for Italiani Al Lavoro 21. Italiani Al Lavoro 1 pt. 4,488
  2. Avatar for SOU Biochemistry CH455 (2020) 22. SOU Biochemistry CH455 (2020) 1 pt. 2,363
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 1,924
  4. Avatar for NMHU Biol4230 Spr 20 24. NMHU Biol4230 Spr 20 1 pt. 0
  5. Avatar for Biotechnology-105 (2020) 25. Biotechnology-105 (2020) 1 pt. 0
  1. Avatar for bcre8tvv 171. bcre8tvv Lv 1 6 pts. 9,084
  2. Avatar for nspc 172. nspc Lv 1 6 pts. 9,082
  3. Avatar for zackallen 173. zackallen Lv 1 6 pts. 9,077
  4. Avatar for Trajan464 174. Trajan464 Lv 1 6 pts. 9,069
  5. Avatar for Flagg65a 175. Flagg65a Lv 1 6 pts. 9,068
  6. Avatar for momadoc 176. momadoc Lv 1 5 pts. 9,052
  7. Avatar for Lindaxmax 177. Lindaxmax Lv 1 5 pts. 9,029
  8. Avatar for Deleted player 178. Deleted player pts. 9,008
  9. Avatar for jsfoldingaccount 179. jsfoldingaccount Lv 1 5 pts. 8,987
  10. Avatar for Kiwegapa 180. Kiwegapa Lv 1 5 pts. 8,978

Comments

Steven Pletsch Lv 1

I ran my own psipred prediction on this. Only place it varies significantly is that it predicted the small helix to just as likely be a sheet, so I stripped color from any segments that had a low confidence and converted the small helix to a sheet, making a small sheet pair with cysteine at the end of each. Though I haven't been able to get a disulfide bond that keeps the score up, it puts all 3 cysteine together in the same small pocket.