Placeholder image of a protein
Icon representing a puzzle

1835: Coronavirus NSP2 Prediction

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
May 07, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This is one portion of a larger protein encoded in the viral genome of SARS-CoV-2. It is encoded in a region of the genome called NSP2, but the protein's structure and function are still unknown. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


AARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFF

Top groups



  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 88 pts. 11,174
  2. Avatar for jawz101 12. jawz101 Lv 1 87 pts. 11,173
  3. Avatar for pvc78 13. pvc78 Lv 1 86 pts. 11,168
  4. Avatar for spmm 14. spmm Lv 1 85 pts. 11,155
  5. Avatar for Nicm25 15. Nicm25 Lv 1 84 pts. 11,146
  6. Avatar for Susume 16. Susume Lv 1 83 pts. 11,137
  7. Avatar for manu8170 17. manu8170 Lv 1 82 pts. 11,124
  8. Avatar for christioanchauvin 18. christioanchauvin Lv 1 80 pts. 11,093
  9. Avatar for Phyx 19. Phyx Lv 1 79 pts. 11,060
  10. Avatar for robgee 20. robgee Lv 1 78 pts. 11,058

Comments


Steven Pletsch Lv 1

I ran my own psipred prediction on this. Only place it varies significantly is that it predicted the small helix to just as likely be a sheet, so I stripped color from any segments that had a low confidence and converted the small helix to a sheet, making a small sheet pair with cysteine at the end of each. Though I haven't been able to get a disulfide bond that keeps the score up, it puts all 3 cysteine together in the same small pocket.