Placeholder image of a protein
Icon representing a puzzle

1835: Coronavirus NSP2 Prediction

Closed since almost 6 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
May 07, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This is one portion of a larger protein encoded in the viral genome of SARS-CoV-2. It is encoded in a region of the genome called NSP2, but the protein's structure and function are still unknown. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


AARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFF

Top groups

  1. Avatar for Italiani Al Lavoro 21. Italiani Al Lavoro 1 pt. 4,488
  2. Avatar for SOU Biochemistry CH455 (2020) 22. SOU Biochemistry CH455 (2020) 1 pt. 2,363
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 1,924
  4. Avatar for NMHU Biol4230 Spr 20 24. NMHU Biol4230 Spr 20 1 pt. 0
  5. Avatar for Biotechnology-105 (2020) 25. Biotechnology-105 (2020) 1 pt. 0
  1. Avatar for yoctobit 281. yoctobit Lv 1 1 pt. 6,709
  2. Avatar for ucad 282. ucad Lv 1 1 pt. 6,685
  3. Avatar for doctaven 283. doctaven Lv 1 1 pt. 6,625
  4. Avatar for avelis 284. avelis Lv 1 1 pt. 6,596
  5. Avatar for Dr.Sillem 285. Dr.Sillem Lv 1 1 pt. 6,401
  6. Avatar for JasperD 286. JasperD Lv 1 1 pt. 6,339
  7. Avatar for tbhciro 287. tbhciro Lv 1 1 pt. 6,213
  8. Avatar for rlee287 288. rlee287 Lv 1 1 pt. 6,137
  9. Avatar for Nups1983 289. Nups1983 Lv 1 1 pt. 5,961
  10. Avatar for Jenot96 290. Jenot96 Lv 1 1 pt. 5,939

Comments

Steven Pletsch Lv 1

I ran my own psipred prediction on this. Only place it varies significantly is that it predicted the small helix to just as likely be a sheet, so I stripped color from any segments that had a low confidence and converted the small helix to a sheet, making a small sheet pair with cysteine at the end of each. Though I haven't been able to get a disulfide bond that keeps the score up, it puts all 3 cysteine together in the same small pocket.