Placeholder image of a protein
Icon representing a puzzle

1835: Coronavirus NSP2 Prediction

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
May 07, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This is one portion of a larger protein encoded in the viral genome of SARS-CoV-2. It is encoded in a region of the genome called NSP2, but the protein's structure and function are still unknown. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


AARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFF

Top groups



  1. Avatar for delizald 341. delizald Lv 1 1 pt. 1,683
  2. Avatar for justintwayland 342. justintwayland Lv 1 1 pt. 1,387
  3. Avatar for M4rcZ4chary 343. M4rcZ4chary Lv 1 1 pt. 0
  4. Avatar for Phoenum 344. Phoenum Lv 1 1 pt. 0
  5. Avatar for Yupa 345. Yupa Lv 1 1 pt. 0
  6. Avatar for tadhgtim 348. tadhgtim Lv 1 1 pt. 0
  7. Avatar for CODECORRECT 350. CODECORRECT Lv 1 1 pt. 0

Comments


Steven Pletsch Lv 1

I ran my own psipred prediction on this. Only place it varies significantly is that it predicted the small helix to just as likely be a sheet, so I stripped color from any segments that had a low confidence and converted the small helix to a sheet, making a small sheet pair with cysteine at the end of each. Though I haven't been able to get a disulfide bond that keeps the score up, it puts all 3 cysteine together in the same small pocket.