Placeholder image of a protein
Icon representing a puzzle

1835: Coronavirus NSP2 Prediction

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
May 07, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This is one portion of a larger protein encoded in the viral genome of SARS-CoV-2. It is encoded in a region of the genome called NSP2, but the protein's structure and function are still unknown. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


AARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFF

Top groups


  1. Avatar for Hold My Beer 100 pts. 11,576
  2. Avatar for Gargleblasters 2. Gargleblasters 81 pts. 11,374
  3. Avatar for Go Science 3. Go Science 65 pts. 11,358
  4. Avatar for Team India 4. Team India 52 pts. 11,325
  5. Avatar for Marvin's bunch 5. Marvin's bunch 41 pts. 11,303
  6. Avatar for Beta Folders 6. Beta Folders 32 pts. 11,219
  7. Avatar for Contenders 7. Contenders 24 pts. 11,197
  8. Avatar for Anthropic Dreams 8. Anthropic Dreams 18 pts. 11,189
  9. Avatar for Void Crushers 9. Void Crushers 14 pts. 11,155
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 10 pts. 11,124

  1. Avatar for Mickataef 151. Mickataef Lv 1 9 pts. 9,286
  2. Avatar for Tehnologik1 152. Tehnologik1 Lv 1 9 pts. 9,275
  3. Avatar for mikemarkelov 153. mikemarkelov Lv 1 9 pts. 9,258
  4. Avatar for Arne Heessels 154. Arne Heessels Lv 1 9 pts. 9,225
  5. Avatar for knotartist 155. knotartist Lv 1 8 pts. 9,224
  6. Avatar for PeterDeBenedictis 156. PeterDeBenedictis Lv 1 8 pts. 9,221
  7. Avatar for RyeSnake 157. RyeSnake Lv 1 8 pts. 9,203
  8. Avatar for foldthestuffman 158. foldthestuffman Lv 1 8 pts. 9,197
  9. Avatar for harvardman 159. harvardman Lv 1 8 pts. 9,183
  10. Avatar for pfirth 160. pfirth Lv 1 8 pts. 9,183

Comments


Steven Pletsch Lv 1

I ran my own psipred prediction on this. Only place it varies significantly is that it predicted the small helix to just as likely be a sheet, so I stripped color from any segments that had a low confidence and converted the small helix to a sheet, making a small sheet pair with cysteine at the end of each. Though I haven't been able to get a disulfide bond that keeps the score up, it puts all 3 cysteine together in the same small pocket.