Placeholder image of a protein
Icon representing a puzzle

1835: Coronavirus NSP2 Prediction

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
May 07, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This is one portion of a larger protein encoded in the viral genome of SARS-CoV-2. It is encoded in a region of the genome called NSP2, but the protein's structure and function are still unknown. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


AARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFF

Top groups


  1. Avatar for Hold My Beer 100 pts. 11,576
  2. Avatar for Gargleblasters 2. Gargleblasters 81 pts. 11,374
  3. Avatar for Go Science 3. Go Science 65 pts. 11,358
  4. Avatar for Team India 4. Team India 52 pts. 11,325
  5. Avatar for Marvin's bunch 5. Marvin's bunch 41 pts. 11,303
  6. Avatar for Beta Folders 6. Beta Folders 32 pts. 11,219
  7. Avatar for Contenders 7. Contenders 24 pts. 11,197
  8. Avatar for Anthropic Dreams 8. Anthropic Dreams 18 pts. 11,189
  9. Avatar for Void Crushers 9. Void Crushers 14 pts. 11,155
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 10 pts. 11,124

  1. Avatar for Glen B 61. Glen B Lv 1 44 pts. 10,480
  2. Avatar for drumpeter18yrs9yrs 62. drumpeter18yrs9yrs Lv 1 43 pts. 10,454
  3. Avatar for OWM3 64. OWM3 Lv 1 42 pts. 10,442
  4. Avatar for rout 65. rout Lv 1 41 pts. 10,431
  5. Avatar for Deleted player 66. Deleted player 40 pts. 10,428
  6. Avatar for xmbrst 67. xmbrst Lv 1 40 pts. 10,417
  7. Avatar for Black Dahlia 68. Black Dahlia Lv 1 39 pts. 10,409
  8. Avatar for WBarme1234 69. WBarme1234 Lv 1 39 pts. 10,398
  9. Avatar for Simek 70. Simek Lv 1 38 pts. 10,397

Comments


Steven Pletsch Lv 1

I ran my own psipred prediction on this. Only place it varies significantly is that it predicted the small helix to just as likely be a sheet, so I stripped color from any segments that had a low confidence and converted the small helix to a sheet, making a small sheet pair with cysteine at the end of each. Though I haven't been able to get a disulfide bond that keeps the score up, it puts all 3 cysteine together in the same small pocket.