1836: Revisiting Puzzle 115: Exocyst
Closed since almost 6 years ago
Novice Overall PredictionSummary
- Created
- May 08, 2020
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
Sequence:
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK
Top groups
Comments
NinjaGreg Lv 1
It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?
g_b Lv 1
get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.
NinjaGreg Lv 1
Also, on the loading screen there's a text in the upper left "No Tool".
CharlieFortsConscience Lv 1
same message and hang here as well
bkoep Staff Lv 1
Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.
NinjaGreg Lv 1
Thanks for the quick action on that!
Anfinsen_slept_here Lv 1
Had the same pathology as NinjaGreg. Has successfully resolved on my Mac (Yosemite 10.10.5).
Thanks Bkoep.