Placeholder image of a protein
Icon representing a puzzle

1836: Revisiting Puzzle 115: Exocyst

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
May 08, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Marvin's bunch 11. Marvin's bunch 6 pts. 10,745
  2. Avatar for Penny-Arcade 12. Penny-Arcade 4 pts. 10,745
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 3 pts. 10,597
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 2 pts. 10,504
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,435
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 10,149
  7. Avatar for Russian team 17. Russian team 1 pt. 10,087
  8. Avatar for Chem Eng Thermo 18. Chem Eng Thermo 1 pt. 9,752
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,591
  10. Avatar for Fox Folds 20. Fox Folds 1 pt. 9,458

  1. Avatar for fiendish_ghoul 41. fiendish_ghoul Lv 1 45 pts. 10,712
  2. Avatar for WBarme1234 42. WBarme1234 Lv 1 44 pts. 10,711
  3. Avatar for pauldunn 43. pauldunn Lv 1 43 pts. 10,701
  4. Avatar for Anfinsen_slept_here 44. Anfinsen_slept_here Lv 1 42 pts. 10,699
  5. Avatar for Philzord 45. Philzord Lv 1 41 pts. 10,696
  6. Avatar for Deleted player 46. Deleted player pts. 10,681
  7. Avatar for pvc78 47. pvc78 Lv 1 39 pts. 10,659
  8. Avatar for meatexplosion 48. meatexplosion Lv 1 38 pts. 10,648
  9. Avatar for Vinara 49. Vinara Lv 1 37 pts. 10,639
  10. Avatar for silent gene 50. silent gene Lv 1 37 pts. 10,637

Comments


NinjaGreg Lv 1

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

g_b Lv 1

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

bkoep Staff Lv 1

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.