Placeholder image of a protein
Icon representing a puzzle

1836: Revisiting Puzzle 115: Exocyst

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 08, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Dutch Power Cows 21. Dutch Power Cows 1 pt. 9,449
  2. Avatar for Team China 22. Team China 1 pt. 9,392
  3. Avatar for Coastal Biochemistry 23. Coastal Biochemistry 1 pt. 9,355
  4. Avatar for SP26 CHEM 351 Weldon 24. SP26 CHEM 351 Weldon 1 pt. 5,846

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,116
  2. Avatar for robgee 2. robgee Lv 1 86 pts. 11,086
  3. Avatar for alcor29 3. alcor29 Lv 1 74 pts. 11,082
  4. Avatar for Tygh 4. Tygh Lv 1 63 pts. 11,078
  5. Avatar for pauldunn 5. pauldunn Lv 1 53 pts. 11,066
  6. Avatar for mirp 6. mirp Lv 1 44 pts. 11,066
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 37 pts. 11,065
  8. Avatar for pente_player 8. pente_player Lv 1 31 pts. 11,065
  9. Avatar for Czim 9. Czim Lv 1 25 pts. 11,064
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 21 pts. 11,063

Comments


NinjaGreg Lv 1

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

g_b Lv 1

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

bkoep Staff Lv 1

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.