Placeholder image of a protein
Icon representing a puzzle

1836: Revisiting Puzzle 115: Exocyst

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
May 08, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Dutch Power Cows 21. Dutch Power Cows 1 pt. 9,449
  2. Avatar for Team China 22. Team China 1 pt. 9,392
  3. Avatar for Coastal Biochemistry 23. Coastal Biochemistry 1 pt. 9,355
  4. Avatar for SP26 CHEM 351 Weldon 24. SP26 CHEM 351 Weldon 1 pt. 5,846
  1. Avatar for fpc 91. fpc Lv 1 13 pts. 10,178
  2. Avatar for Arne Heessels 92. Arne Heessels Lv 1 13 pts. 10,169
  3. Avatar for Pikkachurin 93. Pikkachurin Lv 1 12 pts. 10,157
  4. Avatar for alwen 94. alwen Lv 1 12 pts. 10,154
  5. Avatar for aendgraend 95. aendgraend Lv 1 12 pts. 10,149
  6. Avatar for joremen 96. joremen Lv 1 11 pts. 10,131
  7. Avatar for dahast.de 97. dahast.de Lv 1 11 pts. 10,126
  8. Avatar for xythus 98. xythus Lv 1 11 pts. 10,122
  9. Avatar for jamiexq 99. jamiexq Lv 1 11 pts. 10,118
  10. Avatar for CAN1958 100. CAN1958 Lv 1 10 pts. 10,117

Comments

NinjaGreg Lv 1

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

g_b Lv 1

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

bkoep Staff Lv 1

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.