Placeholder image of a protein
Icon representing a puzzle

1836: Revisiting Puzzle 115: Exocyst

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 08, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Dutch Power Cows 21. Dutch Power Cows 1 pt. 9,449
  2. Avatar for Team China 22. Team China 1 pt. 9,392
  3. Avatar for Coastal Biochemistry 23. Coastal Biochemistry 1 pt. 9,355
  4. Avatar for SP26 CHEM 351 Weldon 24. SP26 CHEM 351 Weldon 1 pt. 5,846
  1. Avatar for bolloforbio 171. bolloforbio Lv 1 1 pt. 9,589
  2. Avatar for fisherlr777 172. fisherlr777 Lv 1 1 pt. 9,577
  3. Avatar for haggisfam 173. haggisfam Lv 1 1 pt. 9,577
  4. Avatar for RW-QuantumSec 174. RW-QuantumSec Lv 1 1 pt. 9,566
  5. Avatar for AlkiP0Ps 175. AlkiP0Ps Lv 1 1 pt. 9,552
  6. Avatar for Ichprobiersauchmal 176. Ichprobiersauchmal Lv 1 1 pt. 9,542
  7. Avatar for evifnoskcaj 177. evifnoskcaj Lv 1 1 pt. 9,537
  8. Avatar for pascal ochem 178. pascal ochem Lv 1 1 pt. 9,529
  9. Avatar for GAVENvonAHYO 179. GAVENvonAHYO Lv 1 1 pt. 9,526
  10. Avatar for matt61ger 180. matt61ger Lv 1 1 pt. 9,522

Comments

NinjaGreg Lv 1

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

g_b Lv 1

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

bkoep Staff Lv 1

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.