Placeholder image of a protein
Icon representing a puzzle

1836: Revisiting Puzzle 115: Exocyst

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
May 08, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Dutch Power Cows 21. Dutch Power Cows 1 pt. 9,449
  2. Avatar for Team China 22. Team China 1 pt. 9,392
  3. Avatar for Coastal Biochemistry 23. Coastal Biochemistry 1 pt. 9,355
  4. Avatar for SP26 CHEM 351 Weldon 24. SP26 CHEM 351 Weldon 1 pt. 5,846

  1. Avatar for itstonton 191. itstonton Lv 1 1 pt. 9,483
  2. Avatar for EagleGuy 192. EagleGuy Lv 1 1 pt. 9,483
  3. Avatar for Black Dahlia 193. Black Dahlia Lv 1 1 pt. 9,478
  4. Avatar for Miguelan15 194. Miguelan15 Lv 1 1 pt. 9,476
  5. Avatar for YellowBearPL 195. YellowBearPL Lv 1 1 pt. 9,474
  6. Avatar for JoaoJesus 196. JoaoJesus Lv 1 1 pt. 9,473
  7. Avatar for skovz99 197. skovz99 Lv 1 1 pt. 9,472
  8. Avatar for 9racoon 198. 9racoon Lv 1 1 pt. 9,472
  9. Avatar for Trematode1980 199. Trematode1980 Lv 1 1 pt. 9,469
  10. Avatar for nina_gambia 200. nina_gambia Lv 1 1 pt. 9,460

Comments


NinjaGreg Lv 1

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

g_b Lv 1

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

bkoep Staff Lv 1

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.