Placeholder image of a protein
Icon representing a puzzle

1836: Revisiting Puzzle 115: Exocyst

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
May 08, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Dutch Power Cows 21. Dutch Power Cows 1 pt. 9,449
  2. Avatar for Team China 22. Team China 1 pt. 9,392
  3. Avatar for Coastal Biochemistry 23. Coastal Biochemistry 1 pt. 9,355
  4. Avatar for SP26 CHEM 351 Weldon 24. SP26 CHEM 351 Weldon 1 pt. 5,846

  1. Avatar for Xartos 21. Xartos Lv 1 68 pts. 10,899
  2. Avatar for grogar7 22. grogar7 Lv 1 67 pts. 10,894
  3. Avatar for johnmitch 23. johnmitch Lv 1 65 pts. 10,893
  4. Avatar for pmlkjn 24. pmlkjn Lv 1 64 pts. 10,888
  5. Avatar for cbwest 25. cbwest Lv 1 63 pts. 10,868
  6. Avatar for spdenne 26. spdenne Lv 1 62 pts. 10,857
  7. Avatar for christioanchauvin 27. christioanchauvin Lv 1 60 pts. 10,856
  8. Avatar for John McLeod 28. John McLeod Lv 1 59 pts. 10,844
  9. Avatar for Scopper 29. Scopper Lv 1 58 pts. 10,839
  10. Avatar for Polarstern 30. Polarstern Lv 1 57 pts. 10,828

Comments


NinjaGreg Lv 1

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

g_b Lv 1

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

bkoep Staff Lv 1

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.