Placeholder image of a protein
Icon representing a puzzle

1836: Revisiting Puzzle 115: Exocyst

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 08, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Dutch Power Cows 21. Dutch Power Cows 1 pt. 9,449
  2. Avatar for Team China 22. Team China 1 pt. 9,392
  3. Avatar for Coastal Biochemistry 23. Coastal Biochemistry 1 pt. 9,355
  4. Avatar for SP26 CHEM 351 Weldon 24. SP26 CHEM 351 Weldon 1 pt. 5,846
  1. Avatar for vybi 61. vybi Lv 1 28 pts. 10,538
  2. Avatar for Alistair69 62. Alistair69 Lv 1 28 pts. 10,534
  3. Avatar for hansvandenhof 63. hansvandenhof Lv 1 27 pts. 10,526
  4. Avatar for TastyMunchies 64. TastyMunchies Lv 1 26 pts. 10,525
  5. Avatar for rezaefar 65. rezaefar Lv 1 26 pts. 10,517
  6. Avatar for Idiotboy 66. Idiotboy Lv 1 25 pts. 10,516
  7. Avatar for versat82 67. versat82 Lv 1 25 pts. 10,504
  8. Avatar for pangaena 68. pangaena Lv 1 24 pts. 10,457
  9. Avatar for ShadowTactics 69. ShadowTactics Lv 1 23 pts. 10,435
  10. Avatar for andrewxc 70. andrewxc Lv 1 23 pts. 10,431

Comments

NinjaGreg Lv 1

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

g_b Lv 1

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

bkoep Staff Lv 1

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.