Placeholder image of a protein
Icon representing a puzzle

1836: Revisiting Puzzle 115: Exocyst

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 08, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,116
  2. Avatar for Go Science 2. Go Science 81 pts. 11,066
  3. Avatar for Void Crushers 3. Void Crushers 64 pts. 11,011
  4. Avatar for Contenders 4. Contenders 50 pts. 10,984
  5. Avatar for Hold My Beer 5. Hold My Beer 39 pts. 10,961
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 30 pts. 10,953
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 10,950
  8. Avatar for Beta Folders 8. Beta Folders 17 pts. 10,946
  9. Avatar for Team India 9. Team India 12 pts. 10,917
  10. Avatar for CHNO Junkies 10. CHNO Junkies 9 pts. 10,888

  1. Avatar for fiendish_ghoul 41. fiendish_ghoul Lv 1 45 pts. 10,712
  2. Avatar for WBarme1234 42. WBarme1234 Lv 1 44 pts. 10,711
  3. Avatar for pauldunn 43. pauldunn Lv 1 43 pts. 10,701
  4. Avatar for Anfinsen_slept_here 44. Anfinsen_slept_here Lv 1 42 pts. 10,699
  5. Avatar for Philzord 45. Philzord Lv 1 41 pts. 10,696
  6. Avatar for Deleted player 46. Deleted player pts. 10,681
  7. Avatar for pvc78 47. pvc78 Lv 1 39 pts. 10,659
  8. Avatar for meatexplosion 48. meatexplosion Lv 1 38 pts. 10,648
  9. Avatar for Vinara 49. Vinara Lv 1 37 pts. 10,639
  10. Avatar for silent gene 50. silent gene Lv 1 37 pts. 10,637

Comments


NinjaGreg Lv 1

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

g_b Lv 1

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

bkoep Staff Lv 1

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.