Placeholder image of a protein
Icon representing a puzzle

1836: Revisiting Puzzle 115: Exocyst

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 08, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,116
  2. Avatar for Go Science 2. Go Science 81 pts. 11,066
  3. Avatar for Void Crushers 3. Void Crushers 64 pts. 11,011
  4. Avatar for Contenders 4. Contenders 50 pts. 10,984
  5. Avatar for Hold My Beer 5. Hold My Beer 39 pts. 10,961
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 30 pts. 10,953
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 10,950
  8. Avatar for Beta Folders 8. Beta Folders 17 pts. 10,946
  9. Avatar for Team India 9. Team India 12 pts. 10,917
  10. Avatar for CHNO Junkies 10. CHNO Junkies 9 pts. 10,888

  1. Avatar for Hansgeorg 131. Hansgeorg Lv 1 4 pts. 9,957
  2. Avatar for ProfVince 132. ProfVince Lv 1 4 pts. 9,954
  3. Avatar for Feet1stEvolves 133. Feet1stEvolves Lv 1 4 pts. 9,948
  4. Avatar for Auntecedent 134. Auntecedent Lv 1 4 pts. 9,940
  5. Avatar for RyeSnake 135. RyeSnake Lv 1 4 pts. 9,928
  6. Avatar for donuts554 136. donuts554 Lv 1 3 pts. 9,909
  7. Avatar for Hum 137. Hum Lv 1 3 pts. 9,893
  8. Avatar for jsfoldingaccount 138. jsfoldingaccount Lv 1 3 pts. 9,875
  9. Avatar for NPrincipi 139. NPrincipi Lv 1 3 pts. 9,870
  10. Avatar for pfirth 140. pfirth Lv 1 3 pts. 9,866

Comments


NinjaGreg Lv 1

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

g_b Lv 1

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

bkoep Staff Lv 1

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.