Placeholder image of a protein
Icon representing a puzzle

1836: Revisiting Puzzle 115: Exocyst

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 08, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,116
  2. Avatar for Go Science 2. Go Science 81 pts. 11,066
  3. Avatar for Void Crushers 3. Void Crushers 64 pts. 11,011
  4. Avatar for Contenders 4. Contenders 50 pts. 10,984
  5. Avatar for Hold My Beer 5. Hold My Beer 39 pts. 10,961
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 30 pts. 10,953
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 10,950
  8. Avatar for Beta Folders 8. Beta Folders 17 pts. 10,946
  9. Avatar for Team India 9. Team India 12 pts. 10,917
  10. Avatar for CHNO Junkies 10. CHNO Junkies 9 pts. 10,888
  1. Avatar for gdnskye 181. gdnskye Lv 1 1 pt. 9,521
  2. Avatar for mikemarkelov 182. mikemarkelov Lv 1 1 pt. 9,521
  3. Avatar for teunlammetje 183. teunlammetje Lv 1 1 pt. 9,509
  4. Avatar for frostschutz 184. frostschutz Lv 1 1 pt. 9,505
  5. Avatar for cpt_st3rn 185. cpt_st3rn Lv 1 1 pt. 9,503
  6. Avatar for Ertonier 186. Ertonier Lv 1 1 pt. 9,500
  7. Avatar for adessus 187. adessus Lv 1 1 pt. 9,498
  8. Avatar for Wheeler22 188. Wheeler22 Lv 1 1 pt. 9,497
  9. Avatar for hbienert 189. hbienert Lv 1 1 pt. 9,492
  10. Avatar for Rudolfo 190. Rudolfo Lv 1 1 pt. 9,484

Comments

NinjaGreg Lv 1

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

g_b Lv 1

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

bkoep Staff Lv 1

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.