Placeholder image of a protein
Icon representing a puzzle

1836: Revisiting Puzzle 115: Exocyst

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 08, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,116
  2. Avatar for Go Science 2. Go Science 81 pts. 11,066
  3. Avatar for Void Crushers 3. Void Crushers 64 pts. 11,011
  4. Avatar for Contenders 4. Contenders 50 pts. 10,984
  5. Avatar for Hold My Beer 5. Hold My Beer 39 pts. 10,961
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 30 pts. 10,953
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 10,950
  8. Avatar for Beta Folders 8. Beta Folders 17 pts. 10,946
  9. Avatar for Team India 9. Team India 12 pts. 10,917
  10. Avatar for CHNO Junkies 10. CHNO Junkies 9 pts. 10,888
  1. Avatar for suprahet 241. suprahet Lv 1 1 pt. 8,408
  2. Avatar for RedNik87 242. RedNik87 Lv 1 1 pt. 8,371
  3. Avatar for kitek314_pl 243. kitek314_pl Lv 1 1 pt. 8,247
  4. Avatar for jhlee716 244. jhlee716 Lv 1 1 pt. 8,224
  5. Avatar for cinnamonkitty 245. cinnamonkitty Lv 1 1 pt. 7,983
  6. Avatar for thor0385 246. thor0385 Lv 1 1 pt. 7,770
  7. Avatar for ClueEmol 247. ClueEmol Lv 1 1 pt. 7,765
  8. Avatar for Fuad Agaev 248. Fuad Agaev Lv 1 1 pt. 7,711
  9. Avatar for chenang 249. chenang Lv 1 1 pt. 7,487
  10. Avatar for Caraline_nelson 250. Caraline_nelson Lv 1 1 pt. 7,184

Comments

NinjaGreg Lv 1

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

g_b Lv 1

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

bkoep Staff Lv 1

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.