Closed since almost 6 years ago
Intermediate Overall PredictionFold this coronavirus protein! This is the tail portion of a larger protein encoded in the viral genome of SARS-CoV-2. It is encoded in a region of the genome called NSP2, but the protein's structure and function are still unknown. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!
Sequence:
My guess is there are very few known proteins with similar sequences. If the algorithm bases its prediction on proteins that are slightly similar but not really related, it can come up with wildly varying SS predictions.
I think this protein only exists inside the host cell - it is probably not packaged into the capsid when the virus exits the cell to travel to a new host. Instead, when outside the cell, it is carried as instructions in the RNA.
I can't seem to open the puzzle, my game crashes every time I try to open it. I know there have been issues in the past with Macs, so I don't know if that's the problem (since I am using a Mac) but I just thought I would mention it.
wrong puzzle
If 1837 is the puzzle that is crashing for you, open menu, options, and see what the build ID starts with. If it does not start with 20200409, you are running an old version of the game, probably the 32-bit version, which can't handle the new BUNS filter in 1837. If so, you will have to reinstall to get the 64 bit version. Make sure to copy the all.macro and options.txt file out of your game directory before re-installing. Better yet, rename your entire game directory before reinstalling, so you can go get your history (puzzles you have played) out of it later if you want. Reinstalling removes your history.
Better to keep the old version on you Mac, by renaming it.
I tried to re-install (64b) on an old Mac and it didn't work at all. Impossible to come back to the old version of foldit. Since then, I'm running Devprev on the same mac: fortunately I had the old version there. This works very fine but it's impossible to play this BUNS puzzle there, and it doesn't recognise filter or symmetric commands in recent recipes.
An alternative could be to install Linux (Ubuntu) on this Mac, but Linux has it's own problems with Foldit. I've an old PC with linux, but I can only run one client (it was 7 under windows in old times). It's not clear to me if these problems are linked to old computer (defective mastercard) or to system.
0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001111111111111111111111111111111111111111
0000000001111111111222222222233333333334444444444555555555566666666667777777777888888888899999999990000000000111111111122222222223333333333
1234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789 OrigSeq : KLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGG : OrigSeq PsiPred : LHHHHHHHHHHHEEEEELLEEEEEELLLEEEEELLLEEEEEELLHHHHHHHLLLLLLLEEEEEELLEELEEEELLEEEEEEEEEEELLLLLLLLLLLLLLLLEEEELLEEEEEELLLLEEEEELLLLLEELLEEEELLL : PsiPred Jnet : LHHHHHHHHHHHHHHHLLLEELLLLLLHHHHHLLLLLEEEEEHLHHEEEEELLLLLLLEEEEELLLLLLEEEEELEEEEEELLLLLLLLLLHHHLLLLEEEEEEEELLLEEEEELLLLLLELLLLLLEEELLEEELLLL : Jnet jhmm : HHHHHHHHHHHHHHHHLLLEELLLLLLEEEELLLLLLEEEEEELLEEELLLLLLLLLLEEEEELLLLLEEEEEEEEEEEEEEELLLLLLLLLLLLLLLEEEEEEEELLLEEEEELLLLLEEELLLLLEEHHHHHHLLLL : jhmm jpssm : LHHHHHHHHHHHHHHHHLLLLLLLLHHHHHHHHLLLLHHHHHHHHHHHHHELLLLLLLLEEEELLLLLLHHHHHHHHHHLLLLLLHLHHHHHHHHLLLEEEEEEEELLEEEEEELLLLLLLLLLLLLEEELLEEEELLL : jpssm