Placeholder image of a protein
Icon representing a puzzle

1838: Coronavirus NSP2 Prediction: Tail Domain

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
May 14, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This is the tail portion of a larger protein encoded in the viral genome of SARS-CoV-2. It is encoded in a region of the genome called NSP2, but the protein's structure and function are still unknown. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


KLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGG

Top groups


  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 2,097
  2. Avatar for Fox Folds 22. Fox Folds 1 pt. 0
  3. Avatar for Russian team 23. Russian team 1 pt. 0

  1. Avatar for WilliamII 131. WilliamII Lv 1 10 pts. 8,467
  2. Avatar for sciencewalker 132. sciencewalker Lv 1 10 pts. 8,465
  3. Avatar for pmlkjn 133. pmlkjn Lv 1 9 pts. 8,464
  4. Avatar for Mike Cassidy 134. Mike Cassidy Lv 1 9 pts. 8,440
  5. Avatar for pruneau_44 135. pruneau_44 Lv 1 9 pts. 8,436
  6. Avatar for Beany 136. Beany Lv 1 9 pts. 8,432
  7. Avatar for pfirth 137. pfirth Lv 1 9 pts. 8,390
  8. Avatar for jausmh 138. jausmh Lv 1 8 pts. 8,380
  9. Avatar for wudoo 139. wudoo Lv 1 8 pts. 8,368
  10. Avatar for Arne Heessels 140. Arne Heessels Lv 1 8 pts. 8,364

Comments


Susume Lv 1

My guess is there are very few known proteins with similar sequences. If the algorithm bases its prediction on proteins that are slightly similar but not really related, it can come up with wildly varying SS predictions.

I think this protein only exists inside the host cell - it is probably not packaged into the capsid when the virus exits the cell to travel to a new host. Instead, when outside the cell, it is carried as instructions in the RNA.

Pibeagles1 Lv 1

I can't seem to open the puzzle, my game crashes every time I try to open it. I know there have been issues in the past with Macs, so I don't know if that's the problem (since I am using a Mac) but I just thought I would mention it.

Susume Lv 1

If 1837 is the puzzle that is crashing for you, open menu, options, and see what the build ID starts with. If it does not start with 20200409, you are running an old version of the game, probably the 32-bit version, which can't handle the new BUNS filter in 1837. If so, you will have to reinstall to get the 64 bit version. Make sure to copy the all.macro and options.txt file out of your game directory before re-installing. Better yet, rename your entire game directory before reinstalling, so you can go get your history (puzzles you have played) out of it later if you want. Reinstalling removes your history.

Bruno Kestemont Lv 1

Better to keep the old version on you Mac, by renaming it.
I tried to re-install (64b) on an old Mac and it didn't work at all. Impossible to come back to the old version of foldit. Since then, I'm running Devprev on the same mac: fortunately I had the old version there. This works very fine but it's impossible to play this BUNS puzzle there, and it doesn't recognise filter or symmetric commands in recent recipes.

An alternative could be to install Linux (Ubuntu) on this Mac, but Linux has it's own problems with Foldit. I've an old PC with linux, but I can only run one client (it was 7 under windows in old times). It's not clear to me if these problems are linked to old computer (defective mastercard) or to system.

Bruno Kestemont Lv 1

      0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001111111111111111111111111111111111111111
      0000000001111111111222222222233333333334444444444555555555566666666667777777777888888888899999999990000000000111111111122222222223333333333
      1234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789 OrigSeq : KLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGG : OrigSeq PsiPred : LHHHHHHHHHHHEEEEELLEEEEEELLLEEEEELLLEEEEEELLHHHHHHHLLLLLLLEEEEEELLEELEEEELLEEEEEEEEEEELLLLLLLLLLLLLLLLEEEELLEEEEEELLLLEEEEELLLLLEELLEEEELLL : PsiPred     Jnet : LHHHHHHHHHHHHHHHLLLEELLLLLLHHHHHLLLLLEEEEEHLHHEEEEELLLLLLLEEEEELLLLLLEEEEELEEEEEELLLLLLLLLLHHHLLLLEEEEEEEELLLEEEEELLLLLLELLLLLLEEELLEEELLLL : Jnet    jhmm : HHHHHHHHHHHHHHHHLLLEELLLLLLEEEELLLLLLEEEEEELLEEELLLLLLLLLLEEEEELLLLLEEEEEEEEEEEEEEELLLLLLLLLLLLLLLEEEEEEEELLLEEEEELLLLLEEELLLLLEEHHHHHHLLLL : jhmm   jpssm : LHHHHHHHHHHHHHHHHLLLLLLLLHHHHHHHHLLLLHHHHHHHHHHHHHELLLLLLLLEEEELLLLLLHHHHHHHHHHLLLLLLHLHHHHHHHHLLLEEEEEEEELLEEEEEELLLLLLLLLLLLLEEELLEEEELLL : jpssm