Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 5 pts. 9,647
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,594
  3. Avatar for SETI.Germany 13. SETI.Germany 2 pts. 9,569
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 9,526
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,494
  6. Avatar for Hold My Beer 16. Hold My Beer 1 pt. 9,481
  7. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,146
  8. Avatar for Fox Folds 19. Fox Folds 1 pt. 9,099
  9. Avatar for Team Canada 20. Team Canada 1 pt. 8,741

  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 9,766
  2. Avatar for Galaxie 2. Galaxie Lv 1 84 pts. 9,764
  3. Avatar for LociOiling 3. LociOiling Lv 1 70 pts. 9,760
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 57 pts. 9,759
  5. Avatar for Dhalion 5. Dhalion Lv 1 47 pts. 9,759
  6. Avatar for mirp 6. mirp Lv 1 38 pts. 9,758
  7. Avatar for phi16 7. phi16 Lv 1 30 pts. 9,757
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 24 pts. 9,754
  9. Avatar for robgee 9. robgee Lv 1 19 pts. 9,752
  10. Avatar for puxatudo 10. puxatudo Lv 1 15 pts. 9,751

Comments