Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 5 pts. 9,647
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,594
  3. Avatar for SETI.Germany 13. SETI.Germany 2 pts. 9,569
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 9,526
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,494
  6. Avatar for Hold My Beer 16. Hold My Beer 1 pt. 9,481
  7. Avatar for Eastern Prehistoric Force 17. Eastern Prehistoric Force 1 pt. 9,322
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,146
  9. Avatar for Fox Folds 19. Fox Folds 1 pt. 9,099
  10. Avatar for Team Canada 20. Team Canada 1 pt. 8,741
  1. Avatar for rabamino12358 91. rabamino12358 Lv 1 13 pts. 9,451
  2. Avatar for wboler 92. wboler Lv 1 13 pts. 9,445
  3. Avatar for HuubR 93. HuubR Lv 1 12 pts. 9,438
  4. Avatar for allie_heather47 94. allie_heather47 Lv 1 12 pts. 9,434
  5. Avatar for heather-1 95. heather-1 Lv 1 12 pts. 9,430
  6. Avatar for Polarstern 96. Polarstern Lv 1 11 pts. 9,427
  7. Avatar for alcor29 97. alcor29 Lv 1 11 pts. 9,422
  8. Avatar for abiogenesis 98. abiogenesis Lv 1 11 pts. 9,421
  9. Avatar for tangofox10 99. tangofox10 Lv 1 10 pts. 9,419
  10. Avatar for OeshaHari 100. OeshaHari Lv 1 10 pts. 9,417

Comments