Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 5 pts. 9,647
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,594
  3. Avatar for SETI.Germany 13. SETI.Germany 2 pts. 9,569
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 9,526
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,494
  6. Avatar for Hold My Beer 16. Hold My Beer 1 pt. 9,481
  7. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,146
  8. Avatar for Fox Folds 19. Fox Folds 1 pt. 9,099
  9. Avatar for Team Canada 20. Team Canada 1 pt. 8,741

  1. Avatar for Idiotboy 111. Idiotboy Lv 1 7 pts. 9,355
  2. Avatar for Deleted player 112. Deleted player 7 pts. 9,350
  3. Avatar for aniri 113. aniri Lv 1 7 pts. 9,337
  4. Avatar for SEF830 114. SEF830 Lv 1 7 pts. 9,336
  5. Avatar for Chris Klassen 115. Chris Klassen Lv 1 7 pts. 9,336
  6. Avatar for John McLeod 116. John McLeod Lv 1 6 pts. 9,332
  7. Avatar for Karlheinz 117. Karlheinz Lv 1 6 pts. 9,332
  8. Avatar for haggisfam 118. haggisfam Lv 1 6 pts. 9,327
  9. Avatar for sciencewalker 119. sciencewalker Lv 1 6 pts. 9,322
  10. Avatar for wuhongzei 120. wuhongzei Lv 1 6 pts. 9,322

Comments